DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and H04M03.3

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_500885.1 Gene:H04M03.3 / 177359 WormBaseID:WBGene00019153 Length:333 Species:Caenorhabditis elegans


Alignment Length:222 Identity:50/222 - (22%)
Similarity:85/222 - (38%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            ::||.:.|||.....||.:....:....|..::.:.:..:......:..|.:|.|:|....|...
 Worm    53 LITGGTDGIGREAALKLAAEQHEITISGRDPNKAKDVIGQCQMKFNNTPRFIQTDLSLEHEVIKF 117

  Fly    75 FDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKGHV 139
            ...|..:  ..||.|.|||.::.....|.  :..:..:.||::.......:..:|.|..|...|.
 Worm   118 ASQVAEE--QFDICILNAGVMNPKPGRTR--EDREATMMTNLVSSYMIAHKIIDSRRDDQRSLHF 178

  Fly   140 VLINSI---------VGHYIFNPLPGSQQELNMYP-----ATKHAIT--ALTELFRQEMRDFKTK 188
            |...||         :|...|||...:..:.::.|     |.|:||:  .|..|.....:.....
 Worm   179 VFSTSILVKFHNATPLGIRFFNPEKVTDWQKSLVPTDVSGAGKYAISKIGLATLSTSISQCNLPN 243

  Fly   189 VKVTSISPGLVDTELVPLDYKGLPMLQ 215
            :..||:.||.|.|.::    ..||..|
 Worm   244 ITATSVHPGTVYTNIM----SNLPARQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 50/222 (23%)
NADB_Rossmann 1..242 CDD:304358 50/222 (23%)
H04M03.3NP_500885.1 NADB_Rossmann 51..294 CDD:304358 50/222 (23%)
adh_short 52..264 CDD:278532 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.