DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Hsd11b1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus


Alignment Length:221 Identity:54/221 - (24%)
Similarity:93/221 - (42%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            :|||||.|||..:...|...|..||..||..:.|:::             :.:|.....:|.:.:
Mouse    50 IVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKV-------------VSRCLELGAASAHYI 101

  Fly    75 FDAVQGDLGNVDILINNAGKLSGG--------------QLLTMSVDTVQQMLQTNVMGVVYCTQR 125
            ...:: |:...:..|..||||.||              .|....:.:|:::::.|.:..|..:..
Mouse   102 AGTME-DMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTA 165

  Fly   126 AFESMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVK 190
            |...:  :||.|.:.:|:|:.|..       :|..:..|.|:|.|:.......|.|:...|..|.
Mouse   166 ALPML--KQSNGSIAVISSLAGKM-------TQPMIAPYSASKFALDGFFSTIRTELYITKVNVS 221

  Fly   191 VTSISPGLVDTELVPLDYKGLPMLQA 216
            :|....||:|||....:..|:...||
Mouse   222 ITLCVLGLIDTETAMKEISGIINAQA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 54/221 (24%)
NADB_Rossmann 1..242 CDD:304358 54/221 (24%)
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 54/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.