DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Rdh1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_536684.2 Gene:Rdh1 / 107605 MGIID:1195275 Length:317 Species:Mus musculus


Alignment Length:190 Identity:54/190 - (28%)
Similarity:88/190 - (46%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAVF 75
            :||..||.|..:.|:|...|:.|:|..    ..|:..|||......||..:..||:...|:.|..
Mouse    34 ITGCDSGFGNLLARQLDRRGMRVLAAC----LTEKGAEELRNKTSDRLETVILDVTKTESIVAAT 94

  Fly    76 DAVQGDLGNVDI--LINNAG-KLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKG 137
            ..|:..:||..:  |:|||| ....|....|......::|..|::|::..|......:  |:::|
Mouse    95 QWVKERVGNRGLWGLVNNAGISTPSGPNEWMKKQDFARVLDVNLLGMIEVTLSMLPLV--RKARG 157

  Fly   138 HVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPG 197
            .||.::|::|...|  ..|.      |..:|:.:.|.::..|:|:..|  .|||..|.||
Mouse   158 RVVNVSSVMGRMSF--FGGG------YCISKYGVEAFSDSLRRELSYF--GVKVAIIEPG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 54/190 (28%)
NADB_Rossmann 1..242 CDD:304358 54/190 (28%)
Rdh1NP_536684.2 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 54/190 (28%)
adh_short 30..211 CDD:278532 54/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.