DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and hsd11b1l.2

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_004910661.1 Gene:hsd11b1l.2 / 100038278 XenbaseID:XB-GENE-5834068 Length:291 Species:Xenopus tropicalis


Alignment Length:195 Identity:51/195 - (26%)
Similarity:89/195 - (45%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            ::||:|:|||..|..:....|..::..|||..||:::..:..:...:....:..|:.:::|...|
 Frog    37 LITGSSTGIGEQIAYEFAQMGAHIMLTARRHQRLQEVANQCLKLGAASADYVASDMGNLTSAQYV 101

  Fly    75 FDAVQGDLGNVDILINN--AGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKG 137
            .......||.:|.|:.|  .|..|.| .....:|.|...:..|.:..|..|..|..::  ::|:|
 Frog   102 AQETVKKLGGLDYLVLNHIGGSASFG-FFKGDMDPVVGSITINFLSYVQLTSTALRAL--QESQG 163

  Fly   138 HVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLVDTE 202
            .:|:::|:.|. |..|...|      |.|:|.|:.......|:|....|..:.||....|.:|||
 Frog   164 SIVVMSSMSGR-IGAPFTTS------YCASKFALEGFYSSLRREFDLQKNNMSVTVAILGYIDTE 221

  Fly   203  202
             Frog   222  221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 51/195 (26%)
NADB_Rossmann 1..242 CDD:304358 51/195 (26%)
hsd11b1l.2XP_004910661.1 11beta-HSD1_like_SDR_c 31..280 CDD:187593 51/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.