DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and YPT53

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_014306.3 Gene:YPT53 / 855631 SGDID:S000005037 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:69/168 - (41%)
Similarity:100/168 - (59%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PTLNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQE 74
            |||..|.|||||..|||:|:|||::.|.|......|:.|:|:::::: .||:..:..||||||||
Yeast     9 PTLTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT-RDGKVIKFEIWDTAGQE 72

  Fly    75 RFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDL------EE 133
            ||..|.|:|||.:..||:|:|:|:..||.|.::||.||.:..|.:|.:.:||||.||      .|
Yeast    73 RFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENE 137

  Fly   134 QRAVTHDEALQYARTVGAQYVETSAKENEGVAELFELL 171
            .||:...............|.|.|||..|.:.::|:.|
Yeast   138 NRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 66/164 (40%)
Ras 15..177 CDD:278499 66/163 (40%)
YPT53NP_014306.3 Rab5_related 12..180 CDD:206653 66/165 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.