DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and RABG1

DIOPT Version :10

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_568566.1 Gene:RABG1 / 833958 AraportID:AT5G39620 Length:204 Species:Arabidopsis thaliana


Alignment Length:178 Identity:63/178 - (35%)
Similarity:100/178 - (56%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHAL 79
            |.:|||:..||||||:.||.:..|...|.||:....|::::.:.: |:..|.||||||||||.:|
plant     7 KIILLGDSGVGKTSLLKRYNDKDFKQLHNSTIYVDLVTKEICIAE-RQVILQIWDTAGQERFKSL 70

  Fly    80 GPIYYRGSDGALLVYDITDRDSFQKVKSW----VRELRQMRGTEIALIIVGNKTDLE--EQRAVT 138
            ...:||.:|..:||||:....:|:.:.:|    :::......|:...:::|||||:.  :.|.|.
plant    71 PSRFYRDTDCCVLVYDVNTLKTFESIDNWHDEFIKQANPETPTKFPFVLMGNKTDVNNGKPRVVA 135

  Fly   139 HDEALQYARTVG-AQYVETSAKENEGVAELFELLTQLMLEQLSQRQPD 185
            .:.|.|:..:.| ..|.|||||....|.|.|..:.:..|  .::||.|
plant   136 KEIADQWCGSKGNIVYFETSAKAKINVEEAFLEIAKKAL--TNERQID 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 59/167 (35%)
RABG1NP_568566.1 P-loop containing Nucleoside Triphosphate Hydrolases 6..179 CDD:476819 60/174 (34%)

Return to query results.
Submit another query.