DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and rab21

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001016319.1 Gene:rab21 / 549073 XenbaseID:XB-GENE-486436 Length:221 Species:Xenopus tropicalis


Alignment Length:219 Identity:120/219 - (54%)
Similarity:153/219 - (69%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQER 75
            |.:||.|||||||||||||||||.|::||.:|::||||||:::|::: .|:|..|.|||||||||
 Frog    15 TYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNI-GGKRVNLAIWDTAGQER 78

  Fly    76 FHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHD 140
            ||||||||||.|:||:|||||||.|||||||:||:|||:|.|.||.|.|||||.|||::|.|:..
 Frog    79 FHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKVDLEKERHVSVQ 143

  Fly   141 EALQYARTVGAQYVETSAKENEGVAELFELLTQLMLE--QLSQR-------QPDASPLRLQNPDT 196
            ||..||.:|||::..||||:|:|:.|||..|.:.|:|  |..:|       |...|...:|..| 
 Frog   144 EAETYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQTDERAKGNGPSQSGTSRRGVQIVD- 207

  Fly   197 DNLNNSDDSEAPDPGDPAGQRSCC 220
                  |:.:|...|      .||
 Frog   208 ------DEPQAQSTG------GCC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 106/161 (66%)
Ras 15..177 CDD:278499 106/161 (66%)
rab21NP_001016319.1 Rab21 18..179 CDD:133323 106/161 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8991
Inparanoid 1 1.050 222 1.000 Inparanoid score I3447
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226895at2759
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 1 1.000 - - oto104387
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.