DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and Rab11

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:211 Identity:74/211 - (35%)
Similarity:121/211 - (57%) Gaps:13/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78
            ||.||:|:..|||::|:.|:..:.||.:..||:...|.:|.:.: ||:..:..|||||||||:.|
  Fly    12 FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEV-DGKTIKAQIWDTAGQERYRA 75

  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143
            :...||||:.||||||||....:::.|:.|:||||......|.:::||||:||...|:|..|||.
  Fly    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAK 140

  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQ----PDASPLRLQNPDTDNLNNSDD 204
            .:|...|..::||||.::..|...|:.:...:...:||:|    |:...:|..|.:..::..:..
  Fly   141 LFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDVKPTVT 205

  Fly   205 SEAPDPGDPAGQRSCC 220
            ::.        ::.||
  Fly   206 ADV--------RKQCC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 66/161 (41%)
Ras 15..177 CDD:278499 65/161 (40%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 66/161 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.