DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and Rab26

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:100/170 - (58%) Gaps:7/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQH-LSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78
            |.::||:..||||||::|:.:.|:...: |||:...| ..|:.:.||.|.:|.||||||||||.:
  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDF-RNKVVVVDGTRVKLQIWDTAGQERFRS 277

  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLE-EQRAVTHDEA 142
            :...|||.:...||:||:|::.::..:::|:.|:|:....::.::::|||.|.. .:|.|..::.
  Fly   278 VTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDG 342

  Fly   143 LQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQR 182
            .:..|.....::|||||....|    ||....:..||..|
  Fly   343 ERLGREHNVPFMETSAKTGLNV----ELSFTAVARQLKSR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 56/162 (35%)
Ras 15..177 CDD:278499 56/163 (34%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 59/170 (35%)
RAB 214..378 CDD:197555 58/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.