DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and RabX6

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:219 Identity:60/219 - (27%)
Similarity:106/219 - (48%) Gaps:28/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRF--NAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFH 77
            |.:|.|:..|||:||..|:..:.|  :....|||....:.|:.|:.: ::.:|.:|||.|.||..
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNE-KQIKLQLWDTGGMERVA 73

  Fly    78 ALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIA-LIIVGNKTDLEEQRAVTHDE 141
            ::...||:.::||:||:.:.:..||..:...:.::  :...|.| :.|.|||:||:.:.....||
  Fly    74 SVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI--VTYAENAKIFICGNKSDLDGREPEVSDE 136

  Fly   142 AL-----QYARTVGAQYVETSAKENEGVAELF-ELLTQLMLEQLSQRQPDASPLRLQNPDTDN-- 198
            .:     |....:.|.| :||.:...||.|:| ::..||:....|:.:..|...:....||.:  
  Fly   137 EVEAFCEQCHSLISATY-KTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG 200

  Fly   199 -LNNSDDSEAPDPGDPAGQRSCCG 221
             ..|.:|:            |.||
  Fly   201 AATNEEDA------------SSCG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 51/169 (30%)
Ras 15..177 CDD:278499 51/170 (30%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 51/169 (30%)
Rab 10..172 CDD:206640 49/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.