DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and Rab5

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:220 Identity:86/220 - (39%)
Similarity:124/220 - (56%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NGPTLN----FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIW 68
            ||.:.|    ||.|||||..|||:|||||:::.:|:....||:.|:|:::.:.:|| ...:..||
  Fly    20 NGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIED-TVVKFEIW 83

  Fly    69 DTAGQERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEE 133
            |||||||:|:|.|:||||:..|::||||.::||||:.|:||:||.:.....|.:.:.|||.||..
  Fly    84 DTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSN 148

  Fly   134 QRAVTHDEALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDN 198
            .|.|..|||.|||...|..::|||||....|.::|..:.:.:                  |..|.
  Fly   149 IRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKL------------------PKNDG 195

  Fly   199 LNNSDDSEAP---DPGDPAGQRSCC 220
            .||...|..|   :...|.  .:||
  Fly   196 ANNQGTSIRPTGTETNRPT--NNCC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 74/161 (46%)
Ras 15..177 CDD:278499 73/161 (45%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 74/180 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.