DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and RabX2

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:196 Identity:66/196 - (33%)
Similarity:109/196 - (55%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78
            ||.::||:..|||:.|::|:.:|||..::|.|:.....:|.:.|. .|...|.:|||:|.:||::
  Fly     8 FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELV-SRVMMLQVWDTSGDKRFNS 71

  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143
            |.|..||.:.|.|||||||...|||.:..|::|:|:|...::.:::||||:|....|.|:.::..
  Fly    72 LMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGF 136

  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDNLNNSDDSEAP 208
            .||......:.|.|||....|.::|..|...:..:.....| .||:..:..:      .|.:|:|
  Fly   137 NYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLHNP-ISPMPSEQEE------EDAAESP 194

  Fly   209 D 209
            |
  Fly   195 D 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 59/161 (37%)
Ras 15..177 CDD:278499 58/161 (36%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 59/163 (36%)
Rab 8..165 CDD:206640 58/157 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.