DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and Rab9D

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster


Alignment Length:199 Identity:66/199 - (33%)
Similarity:107/199 - (53%) Gaps:12/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLE--DGRRAQ-LNIWDTAGQER 75
            ||.:|||:..||||.|::|:.:::|..:|.||:  ....|:.|:|  |.|..: |.:|||:..||
  Fly     8 FKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTV--GLDRRECSVEFADWRMGRMLQVWDTSDDER 70

  Fly    76 FHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHD 140
            |..|.....|.:.|.|||||||...|||.:..|::|:|::...::.:::||||:|....|.|:..
  Fly    71 FKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMA 135

  Fly   141 EALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDNLNNSDDS 205
            :...||......:.|.|||....|.::|   :.|.::..:.|:...:|..|    |......|.:
  Fly   136 QGFNYAHRQSICFEEVSAKSGRNVYDIF---SSLAMDIYTYRRVHYNPFSL----TSWQEEEDAA 193

  Fly   206 EAPD 209
            |:.|
  Fly   194 ESLD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 59/164 (36%)
Ras 15..177 CDD:278499 58/164 (35%)
Rab9DNP_727432.1 RAB 8..171 CDD:197555 59/167 (35%)
Rab 8..167 CDD:206640 58/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.