DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and RAB21

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_055814.1 Gene:RAB21 / 23011 HGNCID:18263 Length:225 Species:Homo sapiens


Alignment Length:221 Identity:120/221 - (54%)
Similarity:155/221 - (70%) Gaps:22/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GPTLNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQ 73
            |...:||.|||||||||||||||||.|::||.:|::||||||:::|::: .|:|..|.|||||||
Human    15 GRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNI-GGKRVNLAIWDTAGQ 78

  Fly    74 ERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVT 138
            ||||||||||||.|:||:|||||||.|||||||:||:|||:|.|.||.|.|||||.|||::|.|:
Human    79 ERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVS 143

  Fly   139 HDEALQYARTVGAQYVETSAKENEGVAELFELLTQLMLE--QLSQR-------QPDASPLRLQNP 194
            ..||..||.:|||::..||||:|:|:.|||..|.:.|:|  |:.:|       ||..:...:|..
Human   144 IQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQII 208

  Fly   195 DTDNLNNSDDSEAPDPGDPAGQRSCC 220
            |       |:.:|...|.     .||
Human   209 D-------DEPQAQTSGG-----GCC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 106/161 (66%)
Ras 15..177 CDD:278499 106/161 (66%)
RAB21NP_055814.1 Rab21 20..181 CDD:133323 106/161 (66%)
Ras 21..182 CDD:278499 106/161 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160015
Domainoid 1 1.000 215 1.000 Domainoid score I2711
eggNOG 1 0.900 - - E1_KOG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8991
Inparanoid 1 1.050 221 1.000 Inparanoid score I3558
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226895at2759
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 1 1.000 - - oto90589
orthoMCL 1 0.900 - - OOG6_103363
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3888
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.