DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and Rab21

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_077774.1 Gene:Rab21 / 216344 MGIID:894308 Length:222 Species:Mus musculus


Alignment Length:222 Identity:119/222 - (53%)
Similarity:153/222 - (68%) Gaps:25/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GPTLNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQ 73
            |...:||.|||||||||||||||||.|::||.:|::||||||:::|::: .|:|..|.|||||||
Mouse    13 GRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNI-GGKRVNLAIWDTAGQ 76

  Fly    74 ERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVT 138
            ||||||||||||.|:||:||||:||.|||||||:||:|||:|.|.||.|.|||||.|||::|.|:
Mouse    77 ERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVS 141

  Fly   139 HDEALQYARTVGAQYVETSAKENEGVAELFELLTQLMLE--QLSQRQPDASPLRLQNPDTDNLNN 201
            ..||..||.:|||::..||||:|:|:.|||..|.:.|:|  |:.:|...              |.
Mouse   142 IQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKG--------------NG 192

  Fly   202 SDDSEAPDPG------DPAGQRS--CC 220
            |..:.|...|      :|..|.|  ||
Mouse   193 SSQAGAARRGVQIIDDEPQAQSSGGCC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 105/161 (65%)
Ras 15..177 CDD:278499 105/161 (65%)
Rab21NP_077774.1 Rab21 18..179 CDD:133323 105/160 (66%)
Ras 19..180 CDD:278499 104/160 (65%)
Effector region. /evidence=ECO:0000250 46..54 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850385
Domainoid 1 1.000 214 1.000 Domainoid score I2729
eggNOG 1 0.900 - - E1_KOG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8991
Inparanoid 1 1.050 221 1.000 Inparanoid score I3538
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 1 1.000 - - oto94181
orthoMCL 1 0.900 - - OOG6_103363
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3888
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.