DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab21 and rab-21

DIOPT Version :9

Sequence 1:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_495854.1 Gene:rab-21 / 187932 WormBaseID:WBGene00004279 Length:207 Species:Caenorhabditis elegans


Alignment Length:213 Identity:106/213 - (49%)
Similarity:149/213 - (69%) Gaps:19/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQER 75
            :..||.||||||||||:|||||::|::|:.:||||:||||.::.:::|| .:|.|:||||||||:
 Worm    10 SFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVED-CQADLHIWDTAGQEK 73

  Fly    76 FHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHD 140
            :|||||||||||:|.|||:|||||.||:|||:||.|::...|....::|||||.||||:|.||..
 Worm    74 YHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILIVGNKIDLEEERQVTRQ 138

  Fly   141 EALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTD---NLNNS 202
            :|..||.:.||.|:||||::|.|:::.||.||..|:|....|..:.       |.|:   .|.::
 Worm   139 DAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEP-------PSTNRSIRLIDN 196

  Fly   203 DDSEAPDPGDPAGQRSCC 220
            |::|.        .:.||
 Worm   197 DEAER--------SKKCC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 96/161 (60%)
Ras 15..177 CDD:278499 96/161 (60%)
rab-21NP_495854.1 Rab21 13..174 CDD:133323 96/161 (60%)
Ras 14..175 CDD:278499 96/161 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167529
Domainoid 1 1.000 199 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E1_KOG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8991
Inparanoid 1 1.050 207 1.000 Inparanoid score I2410
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226895at2759
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 1 1.000 - - oto20179
orthoMCL 1 0.900 - - OOG6_103363
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3888
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.