DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CBR3

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:242 Identity:64/242 - (26%)
Similarity:107/242 - (44%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVS--AGVIVVGLARRVDRMKAIKEQLPPE-LQGRLHAIHCDVEDL 68
            |||:||||:.|||.|:||.|..  :|.:|: .||.|.|.:|..:||..| |..|.|.:  |::||
Human     6 RVALVTGANRGIGLAIARELCRQFSGDVVL-TARDVARGQAAVQQLQAEGLSPRFHQL--DIDDL 67

  Fly    69 DSVTAAFDWIEEQLGGCDILVNNAG-CLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQ 132
            .|:.|..|::.::.||.::|||||. .......:..:: :.:..|..|..        |.|:|..
Human    68 QSIRALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDI-KAEMTLKTNFF--------ATRNMCN 123

  Fly   133 R-----EVDGHVILINSLTGRNIINPPGDELQ------------VLNM----------------- 163
            .     :..|.|:.|:||..........::||            ::::                 
Human   124 ELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREG 188

  Fly   164 -----YPLTKHGVTAMLEVLRQEL--RGFKTKIKVTSITPGVTDTEI 203
                 |.::|.|||.:..:|.:.|  :....:|.|.:..||...|::
Human   189 WPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 64/242 (26%)
NADB_Rossmann 1..242 CDD:304358 64/242 (26%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4214
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.