Sequence 1: | NP_001036311.2 | Gene: | CG40486 / 3355162 | FlyBaseID: | FBgn0263830 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001227.1 | Gene: | CBR3 / 874 | HGNCID: | 1549 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 242 | Identity: | 64/242 - (26%) |
---|---|---|---|
Similarity: | 107/242 - (44%) | Gaps: | 57/242 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVVTGASSGIGAAVARHLVS--AGVIVVGLARRVDRMKAIKEQLPPE-LQGRLHAIHCDVEDL 68
Fly 69 DSVTAAFDWIEEQLGGCDILVNNAG-CLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQ 132
Fly 133 R-----EVDGHVILINSLTGRNIINPPGDELQ------------VLNM----------------- 163
Fly 164 -----YPLTKHGVTAMLEVLRQEL--RGFKTKIKVTSITPGVTDTEI 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40486 | NP_001036311.2 | YdfG | 1..247 | CDD:226674 | 64/242 (26%) |
NADB_Rossmann | 1..242 | CDD:304358 | 64/242 (26%) | ||
CBR3 | NP_001227.1 | carb_red_PTCR-like_SDR_c | 6..277 | CDD:187585 | 64/242 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4214 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |