DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and NRE1

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:52/212 - (24%)
Similarity:92/212 - (43%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVS--AGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDLD 69
            :|.:|||.|.|||.::...|.|  ...:|.|:||....:|.:||    :...|...:..|:.: |
Yeast     3 KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE----KYGDRFFYVVGDITE-D 62

  Fly    70 SVTAAFDWIEEQL--------GGCDILVNNAGCLNPGQLLT-LELEQLQQVLNVNLMGVVICTRR 125
            ||.       :||        |..|.||.|||.|.|.|.:. :::...:::.::|...:|.....
Yeast    63 SVL-------KQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120

  Fly   126 AFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGV----TAMLEVLRQELRGFK 186
            |...:  ::.:|:|:.::|              ...||| .:..|.    .|.|......|...:
Yeast   121 ALPEL--KKTNGNVVFVSS--------------DACNMY-FSSWGAYGSSKAALNHFAMTLANEE 168

  Fly   187 TKIKVTSITPGVTDTEI 203
            .::|..::.||:.||::
Yeast   169 RQVKAIAVAPGIVDTDM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 52/212 (25%)
NADB_Rossmann 1..242 CDD:304358 52/212 (25%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 52/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.