DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and DHRS11

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_077284.2 Gene:DHRS11 / 79154 HGNCID:28639 Length:260 Species:Homo sapiens


Alignment Length:259 Identity:108/259 - (41%)
Similarity:154/259 - (59%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQ-----GRLHA 60
            ||||.||:|:|||||.||||||||.||..|:.|||.||.|..:    |:|..|.:     |.|..
Human     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNI----EELAAECKSAGYPGTLIP 66

  Fly    61 IHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRR 125
            ..||:.:.:.:.:.|..|..|..|.||.:||||...|..||:......:.:.|||::.:.||||.
Human    67 YRCDLSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTRE 131

  Fly   126 AFRSMQQREV-DGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKI 189
            |::||::|.| |||:|.|||::|..::     .|.|.:.|..||:.|||:.|.||||||..:|.|
Human   132 AYQSMKERNVDDGHIININSMSGHRVL-----PLSVTHFYSATKYAVTALTEGLRQELREAQTHI 191

  Fly   190 KVTSITPGVTDT-----------EILPSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKP 242
            :.|.|:|||.:|           |...:.|..:..|||:|:|..::|||.||||:|:.::.::|
Human   192 RATCISPGVVETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 108/259 (42%)
NADB_Rossmann 1..242 CDD:304358 107/257 (42%)
DHRS11NP_077284.2 Mgc4172-like_SDR_c 6..256 CDD:187601 108/259 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143376
Domainoid 1 1.000 154 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 188 1.000 Inparanoid score I3916
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm40752
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.