DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and dhrs7b

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_012825988.1 Gene:dhrs7b / 779695 XenbaseID:XB-GENE-946473 Length:323 Species:Xenopus tropicalis


Alignment Length:243 Identity:67/243 - (27%)
Similarity:118/243 - (48%) Gaps:33/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRL--------HAIH 62
            |.|.|:|||:||:|...|:...:||..:|...|..:.:|.:.::|.   |.|:        |.:.
 Frog    50 DAVVVITGATSGLGRECAKVFYAAGTRLVLCGRSEEGLKNLVQELS---QMRIKSAQLHKPHMVI 111

  Fly    63 CDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAF 127
            .|:.|:::|.:|.:.|....|..|||:||||....|.:|..::...:.|::.|..|.|..|:...
 Frog   112 FDLSDVEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALI 176

  Fly   128 RSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVT 192
            .||.:.. .||:::|:|:.|:  |:.|     ..:.|..:||...|..:.||.|:..:  :|.||
 Frog   177 PSMIKNR-RGHIVVISSVQGK--ISIP-----FRSAYSASKHATQAFFDCLRAEMSPY--EIDVT 231

  Fly   193 SITPGVTDTEIL-------PSGYGILPM-----LKPDDIAAGIMYVLG 228
            .:.||...|.:.       .|.||::..     ..|:::|..::..:|
 Frog   232 VVNPGYIKTNLSLNAVTGDGSNYGVMDNNTAEGRTPEEVAQTVLRAVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 67/243 (28%)
NADB_Rossmann 1..242 CDD:304358 67/243 (28%)
dhrs7bXP_012825988.1 11beta-HSD1_like_SDR_c 48..309 CDD:187593 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.