DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and RDH8

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:201 Identity:56/201 - (27%)
Similarity:85/201 - (42%) Gaps:18/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVA---RHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDL 68
            |..:::|.|||||..:|   .|.......||...|.:.:.:.::......|...|.....||...
Human     6 RTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSD 70

  Fly    69 DSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQR 133
            :||......|:   |..|:||||||....|.|..|.|..:|.|.:.|..|.|...:.....|::|
Human    71 ESVAQCLSCIQ---GEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRR 132

  Fly   134 EVDGHVILINSLTGRN--IINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITP 196
            . .||:::|:|:.|..  |.|         ::|..:|..:....|.|..:|..|...|.:....|
Human   133 R-QGHIVVISSVMGLQGVIFN---------DVYAASKFALEGFFESLAIQLLQFNIFISLVEPGP 187

  Fly   197 GVTDTE 202
            .||:.|
Human   188 VVTEFE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 56/201 (28%)
NADB_Rossmann 1..242 CDD:304358 56/201 (28%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 56/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.