Sequence 1: | NP_001036311.2 | Gene: | CG40486 / 3355162 | FlyBaseID: | FBgn0263830 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056540.3 | Gene: | RDH8 / 50700 | HGNCID: | 14423 | Length: | 311 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 56/201 - (27%) |
---|---|---|---|
Similarity: | 85/201 - (42%) | Gaps: | 18/201 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVVTGASSGIGAAVA---RHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDL 68
Fly 69 DSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQR 133
Fly 134 EVDGHVILINSLTGRN--IINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITP 196
Fly 197 GVTDTE 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40486 | NP_001036311.2 | YdfG | 1..247 | CDD:226674 | 56/201 (28%) |
NADB_Rossmann | 1..242 | CDD:304358 | 56/201 (28%) | ||
RDH8 | NP_056540.3 | type1_17beta-HSD-like_SDR_c | 6..262 | CDD:187666 | 56/201 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |