DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and dhrs11b.2

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_005157476.1 Gene:dhrs11b.2 / 436969 ZFINID:ZDB-GENE-040718-449 Length:255 Species:Danio rerio


Alignment Length:258 Identity:101/258 - (39%)
Similarity:150/258 - (58%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAI-KEQLPPELQGRLHAIHCD 64
            |:||..||.:|||||.|||||:|:.||..|:.|||.||.|:::|.: .|.:.....|.|....||
Zfish     1 MDRWRGRVVLVTGASVGIGAAIAKSLVQHGMKVVGCARNVEQIKKLAAECVSSGYSGALFPYKCD 65

  Fly    65 VEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRS 129
            :...|.|.:.|.||:.|..|.|:.:||||...|..||:.:....:.:::||:|.:.:|||.|::|
Zfish    66 LSVEDEVLSMFSWIKAQHKGVDVCINNAGLALPEPLLSGKTSSWRTMMDVNVMALAVCTREAYQS 130

  Fly   130 MQQREV-DGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTS 193
            |::|:| |||:|.|||:.|..::|....     :.|..||:.|||:.|.||||||..||.|:.|.
Zfish   131 MKERKVDDGHIININSICGHRVLNYADG-----HFYTATKYAVTALTEGLRQELREAKTHIRATG 190

  Fly   194 ITPGVTDTEI-----------LPSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKPLGE 245
            |:||:..||.           ..:.|.....|:.|||...::|||..|.|||:.::.:.|:.:
Zfish   191 ISPGIVKTEFAYRLFSDDQEKAAAMYNSGECLQADDITNAVVYVLSAPPHVQIGDIELTPVDQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 101/258 (39%)
NADB_Rossmann 1..242 CDD:304358 100/253 (40%)
dhrs11b.2XP_005157476.1 YdfG 1..255 CDD:226674 101/258 (39%)
Mgc4172-like_SDR_c 1..250 CDD:187601 100/253 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576252
Domainoid 1 1.000 169 1.000 Domainoid score I3763
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3745
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.