DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG7601

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:239 Identity:62/239 - (25%)
Similarity:106/239 - (44%) Gaps:37/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL---------PPELQGRLHAIH 62
            :|.::||||||:|.::|.....||..|:..|||...::.:|:.|         ||.:      :.
  Fly    54 KVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTV------LP 112

  Fly    63 CDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAF 127
            .|:.:|:|:......:.......|||:||.|......:.:..::...:|:.||..|.|..|:...
  Fly   113 LDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALL 177

  Fly   128 RSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVT 192
            .||.:|. .||:..|:|:.|:..|....       .|..:||.:.|..:.||.|:.  ...|.|:
  Fly   178 PSMVKRG-SGHICFISSVQGKFAIPQRA-------AYSASKHAMQAFADSLRAEVA--NKNINVS 232

  Fly   193 SITPGVTDTEI-------LPSGYGILPM-----LKPDDIAAGIM 224
            .::||...|::       ..|.||.:..     :.||.:|..|:
  Fly   233 CVSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMSPDKLAERIL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 62/239 (26%)
NADB_Rossmann 1..242 CDD:304358 62/239 (26%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 62/239 (26%)
PRK06181 53..314 CDD:235726 62/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435166
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.