DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG31546

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:256 Identity:57/256 - (22%)
Similarity:98/256 - (38%) Gaps:66/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL----------------PPELQ 55
            :|.::|||:||||||.|......|..:..:.|..:.:..:.::.                |||  
  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPE-- 76

  Fly    56 GRLHAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVV 120
                 |.|         .|....|...|..|:|||.||.:..|.|.:.||.....|:..|:....
  Fly    77 -----IEC---------IARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGF 127

  Fly   121 ICTRRAFRSMQQREVDGHVILINSLTG-RNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQEL-- 182
            ..|:.....:.|  ..|.::.::|:.| |...|        |..|.::|..|......|..:|  
  Fly   128 YLTKLLLPQLLQ--CKGSIVNVSSVCGLRAFPN--------LVAYNMSKAAVDQFTRSLALDLGP 182

  Fly   183 RGFKTKIKVTSITPGVTDTEILPSG-----------------YGILPMLKPDDIAAGIMYV 226
            :|    ::|.::.|||..|.:..:|                 :.:..:.:|.::||.|.::
  Fly   183 QG----VRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 57/256 (22%)
NADB_Rossmann 1..242 CDD:304358 57/256 (22%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 57/256 (22%)
NADB_Rossmann 11..261 CDD:304358 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.