DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG31549

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:116/250 - (46%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL-------PPELQGRL 58
            |..:.|:|.:||||||||||:.|.||...|.::|.:.|..:::|...:.:       |.|||..:
  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADM 65

  Fly    59 HAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICT 123
             ....:|:.:...|.|      :.|..|:||||||.|..|.:....|||..:::|.|:..:...|
  Fly    66 -TKEAEVQQIVGATLA------KHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLT 123

  Fly   124 RRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQEL--RGFK 186
            ..|...:.:.:  |:::.::|:.|....  ||    || .|.::|..|......:..||  :|  
  Fly   124 MLATPELVKTK--GNIVNVSSVCGLRAF--PG----VL-AYNVSKAAVDQFTACIALELAPKG-- 177

  Fly   187 TKIKVTSITPGVTDTEILPSG------YG-ILPMLKPDDIAAGIMYVLGTPAHVQ 234
              ::|.::.|||..|:|...|      |. .|...|       |.:.||.|..|:
  Fly   178 --VRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCK-------ITHALGRPGDVK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 72/249 (29%)
NADB_Rossmann 1..242 CDD:304358 72/249 (29%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 71/246 (29%)
fabG 4..251 CDD:235975 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.