DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG10672

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:255 Identity:59/255 - (23%)
Similarity:115/255 - (45%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDV 65
            |:|...:|||||.::.|||.|:|:.|...|..||..:|:...:.:...:| .:|...:|.:.|.|
  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAEL-RKLNLNVHGLKCHV 129

  Fly    66 EDLDSVTAAFDWIEEQLGGCDILVNNAGCLNP--GQLLTLELEQLQQVLNVNLMGVVICTRRAFR 128
            .:.:.....|:....:.|..:|||:|| ..||  |.:|..:.:...::.:||:....:..:.|..
  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNA-ATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALP 193

  Fly   129 SMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTS 193
            .::|:: :..::.::|:.|.       |..::|..|.::|..:..:.:...::|.  ...|:|..
  Fly   194 LLRQQK-NSSIVFVSSIAGY-------DAFELLGAYSVSKTALIGLTKAAAKDLA--PEGIRVNC 248

  Fly   194 ITPGVTDTEI-----------------LPSG--------YGILPMLKPDDIAAGIMYVLG 228
            :.|||..|:.                 :|.|        .|::..|..:|  ||  |:.|
  Fly   249 LAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSED--AG--YITG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 59/255 (23%)
NADB_Rossmann 1..242 CDD:304358 59/255 (23%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 58/254 (23%)
fabG 67..316 CDD:235975 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.