DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and dhs-6

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:251 Identity:55/251 - (21%)
Similarity:90/251 - (35%) Gaps:79/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLH------------ 59
            |..::||||.|||..:|..|...|..:|..|:..        ...|:|.|.::            
 Worm    10 RTVLITGASRGIGKEIALKLAKDGANIVVAAKTA--------TAHPKLPGTIYSAAEEIEKAGGK 66

  Fly    60 AIHC--DVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVIC 122
            |:.|  ||.|..||.|:.:...::.||.|||:|||..::.......|:::...:.::|..|..:.
 Worm    67 ALPCIVDVRDEASVKASVEEAVKKFGGIDILINNASAISLTDTENTEMKRYDLMHSINTRGTFLM 131

  Fly   123 TRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKT 187
            |:.....::              :|:|    |    .|||:.|           .|..|.|.|..
 Worm   132 TKTCLPYLK--------------SGKN----P----HVLNISP-----------PLLMETRWFAN 163

  Fly   188 KIKVTSITPGVTDTEILPSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKPL 243
            .:..|....|::                        |.|||.....:.|.:.:..|
 Worm   164 HVAYTMAKYGMS------------------------MCVLGQHEEFRPHGIAVNAL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 55/251 (22%)
NADB_Rossmann 1..242 CDD:304358 54/248 (22%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 55/251 (22%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.