DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG9150

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster


Alignment Length:252 Identity:120/252 - (47%)
Similarity:166/252 - (65%) Gaps:6/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDV 65
            ||||.:::|||||||.|||||.||.::.||:.|||||||..::|.::|.||.|||.......|||
  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDV 65

  Fly    66 EDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLT-LELEQLQQVLNVNLMGVVICTRRAFRS 129
            ...|.|.::|||||.:|.|.|:|:||||.....:|:| ...::|::|::.|:|||:.|||.||.:
  Fly    66 SKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130

  Fly   130 MQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSI 194
            |::|..:|||::|||:.|..::|.. |.|...|:||.||..:||:.|..|||.:....||:||.|
  Fly   131 MKRRGGEGHVLIINSIAGHQVLNFI-DVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGI 194

  Fly   195 TPGVTDTEILPSGYGI----LPMLKPDDIAAGIMYVLGTPAHVQVHELTIKPLGEPF 247
            .||..:|.|.|.....    :..|:|.:||..:||.|.||.||||||:||||:||.|
  Fly   195 CPGAVNTNIFPEEIHFYVKDMARLEPANIADAVMYALRTPPHVQVHEITIKPMGEMF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 119/250 (48%)
NADB_Rossmann 1..242 CDD:304358 115/245 (47%)
CG9150NP_608991.2 YdfG 1..251 CDD:226674 119/250 (48%)
NADB_Rossmann 1..247 CDD:304358 116/246 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442635
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1211.810

Return to query results.
Submit another query.