DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and HSD11B1

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens


Alignment Length:232 Identity:52/232 - (22%)
Similarity:99/232 - (42%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVE 66
            |....:..:|||||.|||..:|.||...|..||..||..:.::.:............|.|...:|
Human    30 EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME 94

  Fly    67 DLDSVTAAFDWIEEQ---LGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFR 128
            |:   |.|..::.:.   :||.|:|:.|........|...::..:::.:.||.:..|:.|..|..
Human    95 DM---TFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP 156

  Fly   129 SMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTS 193
            .::|.  :|.:::::||.|: :..|      ::..|..:|..:......:|:|....:..:.:|.
Human   157 MLKQS--NGSIVVVSSLAGK-VAYP------MVAAYSASKFALDGFFSSIRKEYSVSRVNVSITL 212

  Fly   194 ITPGVTDTEILPSGYGILPMLKPDDIAAGIMYVLGTP 230
            ...|:.|||.....            .:||:::...|
Human   213 CVLGLIDTETAMKA------------VSGIVHMQAAP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 52/232 (22%)
NADB_Rossmann 1..242 CDD:304358 52/232 (22%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 51/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.