DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG31937

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:210 Identity:59/210 - (28%)
Similarity:100/210 - (47%) Gaps:21/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLH-----AIHCDVE 66
            :|..:||||||||.|:|..|...||.:|..|||:::::.::|:.....:|.|.     .|..|:.
  Fly    47 QVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDML 111

  Fly    67 DLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFR-SM 130
            |||......:.:.......|:||||||.........:|:|..:::..:::..||..:|...| .:
  Fly   112 DLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFV 176

  Fly   131 QQREVDGHVILINSLTGRNII--NPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTS 193
            :|....||:...:|:.|.:.:  :|         .|...||.:.|.|..|:.|:|    |:.|:.
  Fly   177 EQNGGRGHIAATSSIAGFSPVPFSP---------TYCAAKHALNAYLLSLKVEMR----KLDVSL 228

  Fly   194 ITPGVTDTEILPSGY 208
            ..||...|:.|...:
  Fly   229 FAPGPIATDFLQEAF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 59/210 (28%)
NADB_Rossmann 1..242 CDD:304358 59/210 (28%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 59/210 (28%)
adh_short 47..245 CDD:278532 59/210 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.