DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and CG31548

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:206 Identity:63/206 - (30%)
Similarity:102/206 - (49%) Gaps:21/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDV-EDLDS 70
            :|.::||||||||||.|......|..:....|.|:.:|.:..:.....|.:...:..|: ::.|:
  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEADT 70

  Fly    71 VTAAFDWIE--EQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQR 133
            ...   |.|  :|.|..|:||||||.:..|.:.|..|||..:|:|.||..:...|..|...:.:.
  Fly    71 QRI---WSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132

  Fly   134 EVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQEL--RGFKTKIKVTSITP 196
            :  |:::.::|:.|  |.:.||    || .|.::|.||......:..||  :|    ::|..:.|
  Fly   133 K--GNIVNVSSVNG--IRSFPG----VL-AYNISKMGVDQFTRCVALELAAKG----VRVNCVNP 184

  Fly   197 GVTDTEILPSG 207
            |||.|.:...|
  Fly   185 GVTVTNLHARG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 63/206 (31%)
NADB_Rossmann 1..242 CDD:304358 63/206 (31%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 63/206 (31%)
NADB_Rossmann 3..253 CDD:304358 63/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.