DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and Dhrs7

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001258323.1 Gene:Dhrs7 / 299135 RGDID:1565002 Length:338 Species:Rattus norvegicus


Alignment Length:209 Identity:60/209 - (28%)
Similarity:94/209 - (44%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WH--DRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLH-----AI 61
            |.  |.|..:||||||||..:|..|...||.:|..|||...::.:|.:...  .|.|.     .:
  Rat    46 WELTDMVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLE--NGNLKEKDILVL 108

  Fly    62 HCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRA 126
            ..|:.|..|..||...:.::.|..||||||.|......:|...||..::::|:|.:|.|..|:..
  Rat   109 PLDLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLEVFKELMNLNYLGTVSLTKCV 173

  Fly   127 FRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKV 191
            ...|.:|: .|.::.:|||.|...::       :.:.|..:||.:......|..||..:      
  Rat   174 LPHMVERK-QGKIVTVNSLAGIASVS-------LSSGYCASKHALRGFFNALHSELGKY------ 224

  Fly   192 TSITPGVTDTEILP 205
                ||:|...:.|
  Rat   225 ----PGITLCNVYP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 60/209 (29%)
NADB_Rossmann 1..242 CDD:304358 60/209 (29%)
Dhrs7NP_001258323.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 59/207 (29%)
adh_short 52..250 CDD:278532 58/203 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.