DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:216 Identity:67/216 - (31%)
Similarity:105/216 - (48%) Gaps:22/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL--PPELQGRLH---AIHCDVED 67
            |.|||||:||:|...||...:||..||...|.|..::....:|  ....||:.|   .:..|:.|
  Rat    54 VVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTFDLAD 118

  Fly    68 LDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQ 132
            ..::..|...|.:..|..|||:||||....|.:....::..::|:.:|..|.|..|:....||.:
  Rat   119 PGAIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVE 183

  Fly   133 REVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPG 197
            |: .||::.|:|:.|:  |:.|     ..:.|..:||...|..:.||.|::  .:.|:||.|:||
  Rat   184 RK-RGHIVAISSIQGK--ISIP-----FRSAYAASKHATQAFFDCLRAEMK--DSDIEVTVISPG 238

  Fly   198 VTDTEIL-------PSGYGIL 211
            ...|.:.       .|.||.|
  Rat   239 YIHTNLSVNAVTADGSRYGAL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 67/216 (31%)
NADB_Rossmann 1..242 CDD:304358 67/216 (31%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 67/216 (31%)
PRK06181 52..321 CDD:235726 67/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.