DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and rdh8a

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:269 Identity:64/269 - (23%)
Similarity:114/269 - (42%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARR-------VDRMKAIKE-----QLPPELQGR-L 58
            :|.::||.|||||..:|          |.|||.       :..|:.:|:     :...|:.|: |
Zfish     8 KVVLITGCSSGIGLRIA----------VLLARDEQKRYHVIATMRDLKKKDRLVEAAGEVYGQTL 62

  Fly    59 HAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICT 123
            ..:..|:...:||....:.::::  ..|:|:||||....|.:.::.::::::|...|..|.|...
Zfish    63 TLLPLDICSDESVRQCVNSVKDR--HIDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVRMI 125

  Fly   124 RRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQ--VLN-MYPLTKHGVTAMLEVLRQELRGF 185
            :.....|::|:. ||:|:::|:.|          ||  |.| :|..:|..:....|.:..:|  .
Zfish   126 KEVMPDMKKRQA-GHIIIMSSVMG----------LQGVVFNDVYTASKFAIEGFCESMAVQL--L 177

  Fly   186 KTKIKVTSITPGVTDTEI----------------------------LPSGYGILPML--KPDDIA 220
            |..:|::.|.||...||.                            :||...|...:  .|||||
Zfish   178 KFNVKLSLIEPGPVHTEFETKMMEEVAKMEYPGADPDTVRYFKDVYVPSSIDIFEAMGQTPDDIA 242

  Fly   221 AGIMYVLGT 229
            .....|:.|
Zfish   243 KCTKKVIET 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 64/269 (24%)
NADB_Rossmann 1..242 CDD:304358 64/269 (24%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 64/269 (24%)
adh_short 8..207 CDD:278532 54/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.