DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and SPCC162.03

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_588241.1 Gene:SPCC162.03 / 2539382 PomBaseID:SPCC162.03 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:54/198 - (27%)
Similarity:95/198 - (47%) Gaps:26/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAVARHLVSAGVIVVGLAR-----RVDRMKAIKEQLPPELQGRLHAIHCDVEDLD 69
            ::||:|.|:|.|:.:..::.|..|:..:|     .::..|.:|.:|             ||.|:.
pombe     9 LITGSSKGLGYALVKVGLAQGYNVIACSRAPDTITIEHSKLLKLKL-------------DVTDVK 60

  Fly    70 SVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQRE 134
            ||..||...:.:.|..||::||||....|:..:..:|::.:.:|||..||...|:.|...|::..
pombe    61 SVETAFKDAKRRFGNVDIVINNAGYGLVGEFESYNIEEMHRQMNVNFWGVAYITKEALNLMRESG 125

  Fly   135 VDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPGVT 199
            ..|.::.|:|:.|..    |.   ..|:||..:|..|..:.:.:.:||.. ...|.:|.:.||..
pombe   126 KGGRILQISSVAGYY----PS---PCLSMYNASKFAVEGLSQTIMRELDP-NWNIAITIVQPGGM 182

  Fly   200 DTE 202
            .||
pombe   183 QTE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 54/198 (27%)
NADB_Rossmann 1..242 CDD:304358 54/198 (27%)
SPCC162.03NP_588241.1 17beta-HSD-like_SDR_c 7..248 CDD:187632 54/198 (27%)
PRK08263 9..257 CDD:181334 54/198 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1885
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.