DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and Hsd17b1

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_036983.1 Gene:Hsd17b1 / 25322 RGDID:2836 Length:344 Species:Rattus norvegicus


Alignment Length:225 Identity:66/225 - (29%)
Similarity:94/225 - (41%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIK--------------------EQLPP 52
            |.::||.|||||..:|..|.|            ||.::.|                    :..||
  Rat     5 VVLITGCSSGIGLHLAVRLAS------------DRSQSFKVYATLRDLKSQGPLLEAARAQGCPP 57

  Fly    53 ELQGRLHAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLM 117
               |.|..:..||.|.:||.||...:.|  |..|:||.|||....|.|...||..:..||:||::
  Rat    58 ---GSLEILELDVRDSESVAAARACVTE--GRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVL 117

  Fly   118 GVVICTRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQEL 182
            | .|...:||....:|...|.|::..|:.|  ::..|..|:...:.:.|  .|:...|.:| ..|
  Rat   118 G-TIRMLQAFLPDMKRRHSGRVLVTASVGG--LMGLPFHEVYCASKFAL--EGLCESLAIL-LPL 176

  Fly   183 RGFKTKIKVTSITPGVTDT---EILPSGYG 209
            .|    :.|:.|..|...|   |.|..|.|
  Rat   177 FG----VHVSLIECGAVHTAFHEKLEGGPG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 66/225 (29%)
NADB_Rossmann 1..242 CDD:304358 66/225 (29%)
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:419666 66/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.