Sequence 1: | NP_001036311.2 | Gene: | CG40486 / 3355162 | FlyBaseID: | FBgn0263830 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025461.1 | Gene: | Rdh8 / 235033 | MGIID: | 2685028 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 257 | Identity: | 68/257 - (26%) |
---|---|---|---|
Similarity: | 103/257 - (40%) | Gaps: | 47/257 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVVTGASSGIGAAVARHLV---SAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDL 68
Fly 69 DSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQR 133
Fly 134 EVDGHVILINSLTGRNIINPPGDELQVL---NMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSIT 195
Fly 196 PGVTDTE--------------------------ILPSGYGILPML--KPDDIAAGIMYVLGT 229 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40486 | NP_001036311.2 | YdfG | 1..247 | CDD:226674 | 68/257 (26%) |
NADB_Rossmann | 1..242 | CDD:304358 | 68/257 (26%) | ||
Rdh8 | NP_001025461.1 | NADB_Rossmann | 6..263 | CDD:304358 | 68/257 (26%) |
adh_short | 6..201 | CDD:278532 | 59/207 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |