DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:214 Identity:66/214 - (30%)
Similarity:106/214 - (49%) Gaps:20/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLH---AIHCDVEDLD 69
            |.|||||:||:|...|:...:||..:|...|.|..::.:..:|....||:.|   .:..|:.|..
Mouse    54 VVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLADPG 118

  Fly    70 SVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQRE 134
            ::.||...|.:..|..|:|:||||....|.:....::..::|:.:|..|.|..|:....||.:|:
Mouse   119 TIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERK 183

  Fly   135 VDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPGVT 199
             .||::.|:|:.|:  |:.|     ..:.|..:||...|..:.||.|:.  :..||||.|:||..
Mouse   184 -QGHIVAISSIQGK--ISIP-----FRSAYSASKHATQAFFDCLRAEME--EANIKVTVISPGYI 238

  Fly   200 DTEIL-------PSGYGIL 211
            .|.:.       .|.||.|
Mouse   239 HTNLSVNAVTADGSRYGAL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 66/214 (31%)
NADB_Rossmann 1..242 CDD:304358 66/214 (31%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 66/214 (31%)
PRK06181 52..319 CDD:235726 66/214 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.