Sequence 1: | NP_001036311.2 | Gene: | CG40486 / 3355162 | FlyBaseID: | FBgn0263830 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663403.1 | Gene: | Dhrs7b / 216820 | MGIID: | 2384931 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 214 | Identity: | 66/214 - (30%) |
---|---|---|---|
Similarity: | 106/214 - (49%) | Gaps: | 20/214 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 VAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLH---AIHCDVEDLD 69
Fly 70 SVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQRE 134
Fly 135 VDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPGVT 199
Fly 200 DTEIL-------PSGYGIL 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40486 | NP_001036311.2 | YdfG | 1..247 | CDD:226674 | 66/214 (31%) |
NADB_Rossmann | 1..242 | CDD:304358 | 66/214 (31%) | ||
Dhrs7b | NP_663403.1 | 11beta-HSD1_like_SDR_c | 50..309 | CDD:187593 | 66/214 (31%) |
PRK06181 | 52..319 | CDD:235726 | 66/214 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |