Sequence 1: | NP_001036311.2 | Gene: | CG40486 / 3355162 | FlyBaseID: | FBgn0263830 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001207422.1 | Gene: | DHRS7C / 201140 | HGNCID: | 32423 | Length: | 312 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 51/206 - (24%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 35/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 DRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAI-----------KEQLPPELQGRLH 59
Fly 60 AIHCDVEDLDSVTAAFDWIEEQLG--GC-DILVNNAG--CLNPGQLLTLELEQLQQVLNVNLMGV 119
Fly 120 VICTRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRG 184
Fly 185 FKTKIKVTSIT 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40486 | NP_001036311.2 | YdfG | 1..247 | CDD:226674 | 51/206 (25%) |
NADB_Rossmann | 1..242 | CDD:304358 | 51/206 (25%) | ||
DHRS7C | NP_001207422.1 | 11beta-HSD1_like_SDR_c | 35..297 | CDD:187593 | 51/206 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |