DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and Dhrs11

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_808232.2 Gene:Dhrs11 / 192970 MGIID:2652816 Length:260 Species:Mus musculus


Alignment Length:259 Identity:104/259 - (40%)
Similarity:152/259 - (58%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQ-----GRLHA 60
            ||||.||:|:|||||.||||||||.||..|:.|||.||.|..:    |:|..|.:     |.|..
Mouse     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNI----EELAAECKSAGYPGTLIP 66

  Fly    61 IHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRR 125
            ..||:.:.:.:.:.|..:..|..|.||.:||||...|..||:......:.:.|||::.:.||||.
Mouse    67 YRCDLSNEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTRE 131

  Fly   126 AFRSMQQREV-DGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKI 189
            |::||::|.: |||:|.|||:.|..:  ||   ..|::.|..||:.|||:.|.|||||...:|.|
Mouse   132 AYQSMKERNIDDGHIININSMCGHRV--PP---QSVIHFYSATKYAVTALTEGLRQELLEAQTHI 191

  Fly   190 KVTSITPGVTDTEI-----------LPSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKP 242
            :.|.|:||:.:|:.           ..:.|..:..|:|:|:|..::|||.||.||||.::.::|
Mouse   192 RATCISPGLVETQFAFKLHDKDPGEAAATYEHIKCLRPEDVAEAVIYVLSTPPHVQVGDIQMRP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 104/259 (40%)
NADB_Rossmann 1..242 CDD:304358 103/257 (40%)
Dhrs11NP_808232.2 YdfG 6..259 CDD:226674 104/259 (40%)
Mgc4172-like_SDR_c 6..256 CDD:187601 104/259 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833544
Domainoid 1 1.000 151 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 188 1.000 Inparanoid score I3893
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm42824
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.