DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and dhs-31

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001255457.1 Gene:dhs-31 / 188051 WormBaseID:WBGene00011424 Length:254 Species:Caenorhabditis elegans


Alignment Length:264 Identity:67/264 - (25%)
Similarity:112/264 - (42%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAG---VIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDL 68
            :...:|||:.|||..:.|.|:...   ||:.| ||.::....::|.  .:...|||||..||.:.
 Worm     4 KTVFITGANRGIGLGIVRKLLKVSEIEVIIAG-ARNLEAANELREL--AKADNRLHAITVDVAND 65

  Fly    69 DSVTAAFDWIEEQLG--GCDILVNNAGCL-------NPGQLLTLELEQLQQVLNVNLMGVVICTR 124
            :.:..:...:|..:|  |.::|:|||||.       :|.:..:|      :..:||.:|.::.::
 Worm    66 ERLANSVKQVESLVGDRGLNLLINNAGCYELYETTDSPSRKASL------KCFDVNAVGSLMASQ 124

  Fly   125 RAFRSMQQREVDGHVILINSLTGRNIINPPGD-ELQVLNMYPLT-------KHGVTAMLEVLRQE 181
            .....:::.....|:..: |.:...|:|...| ..|.||..|..       |....|||...|..
 Worm   125 LFLPLLKKAAAHTHITGL-SASRAAILNIGSDCSSQFLNGTPTVNDVSIAYKMSKVAMLSFARSL 188

  Fly   182 LRGFKT---KIKVTSITPGVTDTEILPSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKPL 243
            ...|:|   .:.:.:|.||...||:..|...|.......||...|.. |.|.....:.|..:.|:
 Worm   189 ASDFRTLNIPVLIATIHPGWVLTEMGGSDAEITVEESATDIVDSIER-LNTSHQGGLFERKLTPM 252

  Fly   244 GEPF 247
              ||
 Worm   253 --PF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 65/262 (25%)
NADB_Rossmann 1..242 CDD:304358 64/257 (25%)
dhs-31NP_001255457.1 adh_short 4..216 CDD:278532 56/221 (25%)
NADB_Rossmann 6..254 CDD:304358 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.