DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and R05D8.9

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:295 Identity:62/295 - (21%)
Similarity:113/295 - (38%) Gaps:87/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDV 65
            :.|:..:||:|||:|:|||.|.|......|..|....|..:|::..::::          :...|
 Worm     2 LSRFSGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEI----------LKSGV 56

  Fly    66 EDLDSVTAAFDWIEE------------QLGGCDILVNNAGCL---NPGQL-LTLELEQLQQVLNV 114
            .:...::.|.|...|            :.|..||||||||..   :.|:: :..::....:::.:
 Worm    57 PESHVLSVATDLAAEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQI 121

  Fly   115 NLMGVVICTRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLR 179
            |:..||..|::|...:.:.:  |.::.::|:.|.....|.      :..|.::|..:........
 Worm   122 NMRSVVTLTQKAKEHLVKAK--GEIVNVSSIAGTAHAQPG------VMYYAMSKSALDQFTRCAA 178

  Fly   180 QELRGFKTKIKVTSITPGVTDT------------------------EILPSGYGILPMLKPDDIA 220
            .:|  .:..::|.|::||...|                        |.:|||    .:.||.|||
 Worm   179 IDL--IQYGVRVNSVSPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSG----AVAKPIDIA 237

  Fly   221 -----------------------AGIMYVLGTPAH 232
                                   .|...|||..||
 Worm   238 NIIAFLADRKLSSYIIGQSIVADGGSTLVLGMNAH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 62/295 (21%)
NADB_Rossmann 1..242 CDD:304358 62/295 (21%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 57/285 (20%)
NADB_Rossmann 5..266 CDD:304358 56/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D460854at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.