DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and F20G2.2

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_506407.1 Gene:F20G2.2 / 184743 WormBaseID:WBGene00008986 Length:249 Species:Caenorhabditis elegans


Alignment Length:254 Identity:64/254 - (25%)
Similarity:113/254 - (44%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCDVEDLDSVTAA 74
            ::|||:.|||..:.:..:....|.:.:|...|..||  |:|......|||.:..|::..:|::..
 Worm     7 LITGANRGIGLGLLKQFLKHKDIQIIIATCRDPSKA--EELSNLKDSRLHILPLDIDCDESISKL 69

  Fly    75 FDWIEEQLG--GCDILVNNAGCLNPGQLLTLELEQ----LQQVLNVNLMGVVICTRRAFRSMQQR 133
            :..:|:.:|  |..:|:||||.|.|   ..:|.|:    |.:.|..|.:...:.|:.....:::.
 Worm    70 YAEVEKLVGEDGLTVLLNNAGILLP---YDVEGEKNRKTLIRQLETNSVSTALITQEFLPLLKKA 131

  Fly   134 EV----DGHVI----LIN-SLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKI 189
            ..    ||:.|    ::| |.|..::....|.....|..|.::|..:.:..:....:|.  |..|
 Worm   132 AAKNGGDGYSINRAAIVNISSTAASVEKIDGTFNGPLVAYRMSKSALNSFAKSCSIDLA--KYHI 194

  Fly   190 KVTSITPGVTDTEILPSGYGILPMLKPDDIAAGI---MYVLGTPAHVQVH---ELTIKP 242
            .|||..||...|.:    .|...||:.:|....:   :..||. ||...:   :||:.|
 Worm   195 LVTSFCPGWVKTGM----GGANAMLEIEDATKTLSDNILTLGN-AHHGAYLNADLTVIP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 64/254 (25%)
NADB_Rossmann 1..242 CDD:304358 63/252 (25%)
F20G2.2NP_506407.1 carb_red_sniffer_like_SDR_c 7..248 CDD:187586 63/252 (25%)
adh_short 7..208 CDD:278532 53/207 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4214
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.