DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and dhs-30

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_510793.2 Gene:dhs-30 / 181761 WormBaseID:WBGene00000993 Length:311 Species:Caenorhabditis elegans


Alignment Length:208 Identity:61/208 - (29%)
Similarity:93/208 - (44%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLP---PELQGRLHAIHCDVED 67
            ::|.|:||||||:|.::|..|...|..|:.|||..:::|.|.|:|.   |..|......:.|:.|
 Worm    47 NKVVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICEELKETFPLNQNEPIYYYFDITD 111

  Fly    68 LDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQ 132
            .:..    .|.|  :...|||:||||..|.|......:|..:|.:..|..|.|..|:.....:..
 Worm   112 SEQA----PWAE--IPRVDILINNAGMSNRGSCQDTTMEIHRQAMETNYFGHVHVTQALLSKLSP 170

  Fly   133 REVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTS---I 194
               ||.:::.:|:.|:..|...|.       |..:||.:....:.||.|.:..  .|.|.|   |
 Worm   171 ---DGCIVVTSSIQGKVAIPYRGS-------YGASKHALQGYFDCLRAEHKNL--HILVVSAGYI 223

  Fly   195 TPGVTDTEILPSG 207
            ..|.....:.|||
 Worm   224 NTGFGSRALDPSG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 61/208 (29%)
NADB_Rossmann 1..242 CDD:304358 61/208 (29%)
dhs-30NP_510793.2 NADB_Rossmann 45..291 CDD:304358 61/208 (29%)
PRK06181 47..290 CDD:235726 61/208 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.