DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and dhs-18

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_505812.1 Gene:dhs-18 / 179529 WormBaseID:WBGene00000981 Length:293 Species:Caenorhabditis elegans


Alignment Length:214 Identity:51/214 - (23%)
Similarity:90/214 - (42%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRL------------H 59
            :...:||||.|||..:|..|...|..:|..|:..        ...|:|.|.:            |
 Worm    14 KTVFITGASRGIGKEIALKLAKDGANIVVAAKTA--------TAHPKLPGTIYTAAAEIEKAGGH 70

  Fly    60 AIHC--DVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVIC 122
            |:.|  ||.|..:|.||.|...::.||.|||:|||..::.......::::...:.::|..|..:.
 Worm    71 ALPCVVDVRDEAAVKAAVDAAVKKFGGIDILINNASAISLTNTEDTDMKRYDLMHSINTRGTYLL 135

  Fly   123 TRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNM----------YPLTKHGVTAMLEV 177
            |:.....:::.: :.||:         .|:||      |:|          |.:.|.|::..:..
 Worm   136 TKTCLPYLKKGK-NPHVL---------NISPP------LDMEAKWFGPHVGYTMAKFGMSMCVLG 184

  Fly   178 LRQELRGFKTKIKVTSITP 196
            ..:|.|.:  .|.|.::.|
 Worm   185 HHEEFRPY--GIAVNALWP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 51/214 (24%)
NADB_Rossmann 1..242 CDD:304358 51/214 (24%)
dhs-18NP_505812.1 PRK08278 11..279 CDD:181349 51/214 (24%)
adh_short 14..201 CDD:278532 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.