DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and Hsd17b1

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_034605.1 Gene:Hsd17b1 / 15485 MGIID:105077 Length:344 Species:Mus musculus


Alignment Length:191 Identity:56/191 - (29%)
Similarity:81/191 - (42%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIK--------------------EQLPP 52
            |.::||.|||||..:|..|.|            ||.::.|                    :..||
Mouse     5 VVLITGCSSGIGMHLAVRLAS------------DRSQSFKVYATLRDLKAQGPLLEAARTQGCPP 57

  Fly    53 ELQGRLHAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLM 117
               |.|..:..||.|..||.||...:.|  |..|:||.|||....|.|...||..:..||:||::
Mouse    58 ---GSLEILELDVRDSKSVAAAQACVTE--GRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVL 117

  Fly   118 GVVICTRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVL 178
            | .|...:||....:|...|.|::..|:.|  ::..|..|:...:.:.|  .|:...|.:|
Mouse   118 G-TIRMLQAFLPDMKRRHSGRVLVTASVGG--LMGLPFHEVYCASKFAL--EGLCESLAIL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 56/191 (29%)
NADB_Rossmann 1..242 CDD:304358 56/191 (29%)
Hsd17b1NP_034605.1 NADB_Rossmann 4..260 CDD:304358 56/191 (29%)
adh_short 5..192 CDD:278532 56/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.