Sequence 1: | NP_001036311.2 | Gene: | CG40486 / 3355162 | FlyBaseID: | FBgn0263830 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001257285.1 | Gene: | T25G12.13 / 13224720 | WormBaseID: | WBGene00219274 | Length: | 310 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 52/207 - (25%) |
---|---|---|---|
Similarity: | 93/207 - (44%) | Gaps: | 28/207 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 DRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLP---PELQGRLHAIHCDVED 67
Fly 68 LDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQ 132
Fly 133 REVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPG 197
Fly 198 VTDTEILPSGYG 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40486 | NP_001036311.2 | YdfG | 1..247 | CDD:226674 | 52/207 (25%) |
NADB_Rossmann | 1..242 | CDD:304358 | 52/207 (25%) | ||
T25G12.13 | NP_001257285.1 | NADB_Rossmann | 44..290 | CDD:304358 | 52/207 (25%) |
PRK06181 | 46..289 | CDD:235726 | 52/207 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |