DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and XB1000829

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001096251.1 Gene:XB1000829 / 100124812 XenbaseID:XB-GENE-1000830 Length:323 Species:Xenopus tropicalis


Alignment Length:205 Identity:52/205 - (25%)
Similarity:96/205 - (46%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAAVARHLV-------SAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCD 64
            :..::||.|||||.|:|..|.       .....:..||::.|.:.|.:..|...::.:...:.|:
 Frog     4 KTVLITGCSSGIGLAIATKLARDEQKRFKVYATMRNLAKQDDLIAATEGYLGKTMEIKEMDVCCE 68

  Fly    65 VEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRS 129
                ||:......|.::  ..||||:|||....|.:....:|:::.|::.|..|:|...:.....
 Frog    69 ----DSIRNCVSSIPDR--HIDILVSNAGVGLIGPIECQTIEEMKTVMDTNFFGLVRLLKETLPD 127

  Fly   130 MQQREVDGHVILINSLTGRN--IINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVT 192
            |::|: .||:::|:|:.|..  :.|         ::|..:|..|....|.|  .::..|.|:.::
 Frog   128 MKRRK-SGHIVIISSVMGIQGILFN---------DVYAASKFAVEGFCESL--AIQALKFKLHLS 180

  Fly   193 SITPGVTDTE 202
            .|.||...||
 Frog   181 LIEPGPVVTE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 52/205 (25%)
NADB_Rossmann 1..242 CDD:304358 52/205 (25%)
XB1000829NP_001096251.1 type1_17beta-HSD-like_SDR_c 4..261 CDD:187666 52/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.