DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40486 and hsd11b1l.2

DIOPT Version :9

Sequence 1:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_004910661.1 Gene:hsd11b1l.2 / 100038278 XenbaseID:XB-GENE-5834068 Length:291 Species:Xenopus tropicalis


Alignment Length:200 Identity:54/200 - (27%)
Similarity:92/200 - (46%) Gaps:22/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCD--VEDLDSVT 72
            ::||:|:|||..:|......|..::..|||..|::.:..|..     :|.|...|  ..|:.::|
 Frog    37 LITGSSTGIGEQIAYEFAQMGAHIMLTARRHQRLQEVANQCL-----KLGAASADYVASDMGNLT 96

  Fly    73 AAFDWIEE---QLGGCDILVNN--AGCLNPGQLLTLELEQLQQVLNVNLMGVVICTRRAFRSMQQ 132
            :|....:|   :|||.|.||.|  .|..:.| ....:::.:...:.:|.:..|..|..|.|::| 
 Frog    97 SAQYVAQETVKKLGGLDYLVLNHIGGSASFG-FFKGDMDPVVGSITINFLSYVQLTSTALRALQ- 159

  Fly   133 REVDGHVILINSLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTSITPG 197
             |..|.:::::|::||  |..|     ....|..:|..:......||:|....|..:.||....|
 Frog   160 -ESQGSIVVMSSMSGR--IGAP-----FTTSYCASKFALEGFYSSLRREFDLQKNNMSVTVAILG 216

  Fly   198 VTDTE 202
            ..|||
 Frog   217 YIDTE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 53/199 (27%)
NADB_Rossmann 1..242 CDD:304358 53/199 (27%)
hsd11b1l.2XP_004910661.1 11beta-HSD1_like_SDR_c 31..280 CDD:187593 53/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.