DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and CG18249

DIOPT Version :9

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:502 Identity:119/502 - (23%)
Similarity:188/502 - (37%) Gaps:149/502 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   653 LREVRLHNNRIRRVRRGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQDNQLTVLEDI 717
            |||:.|.|...:.:...|.:..|.|:.|.|:..:...|..::...:||:..:.:|...|.||.|.
  Fly    57 LRELHLRNCSRQSITWLVLQLTPGLRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRDQ 121

  Fly   718 FPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNK 782
            ..:....|..:||..|::|.||...|....|                                  
  Fly   122 IFNAVPRLEILQLSQNFIHTVHVAAFQGLSK---------------------------------- 152

  Fly   783 IRDIEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNLKS 847
                          |:.|.|.||.:.::......||.:|..|.|:||.:..:....|||.|.|::
  Fly   153 --------------LRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQT 203

  Fly   848 LDLSHNPLVQLTRDIFSNEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLERNQLNPADIQTLD 912
            |.|:.|||..|..|:..:...|..|:||:.:                ||          ::.||:
  Fly   204 LLLNGNPLRILMPDVLGSLPNLRLLDLGHAA----------------EL----------EVMTLN 242

  Fly   913 IPNLRRLLLSHNNFSYAGSVGIMAGMLDRLRSLQQLSMSNCSLGQIPDLLFAKNTNLVRLDLCDN 977
            :.|::.|:|..::.|   |:.|..|                                        
  Fly   243 LTNVQNLVLEGSSLS---SLVINGG---------------------------------------- 264

  Fly   978 RLTQINRNIFSGLNVFKELRLCRNELSDFPHIALYNLSTLESLDLARNQLASIDFFK-LSGTLNL 1041
                           |.:|:...|||:   |:.:.|.|::..:||..|.|...|... |.|..||
  Fly   265 ---------------FIKLQAGNNELN---HLQVGNKSSVIEMDLHGNLLNGNDTAALLRGMWNL 311

  Fly  1042 RQLILRDNKITAL----SGFNA------VNLTQLDSVDLSGNLLLSLPANFLRHSINLQKVHLSN 1096
            ::|.|..|:|.||    ||.:|      :.|..|..::|:.|.|:.||......|..|..:.||:
  Fly   312 QRLDLSKNRIEALPQHGSGLDASGTQELLILPSLKFLNLANNQLVRLPPESPILSSRLSYLDLSH 376

  Fly  1097 NRFLQIPSSALSDVSIPRLSWLNLTGNPINRI-YTVKEERYPYLKEL 1142
            |..|.:..:.|..:|:  |..|.:.||.:|.| |....|.:|.|.||
  Fly   377 NLMLTLDVAILRSLSV--LKGLYVEGNRLNTINYQKLHEEHPDLSEL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
LRR_8 373..433 CDD:290566
LRR_RI 397..648 CDD:238064
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR_8 465..520 CDD:290566
leucine-rich repeat 486..509 CDD:275380
LRR_8 508..567 CDD:290566
leucine-rich repeat 510..533 CDD:275380
LRR_RI 527..785 CDD:238064 27/131 (21%)
leucine-rich repeat 534..556 CDD:275380
LRR_8 555..613 CDD:290566
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
LRR_8 604..663 CDD:290566 5/9 (56%)
leucine-rich repeat 605..628 CDD:275380
leucine-rich repeat 629..652 CDD:275380
LRR_8 652..711 CDD:290566 14/57 (25%)
leucine-rich repeat 653..676 CDD:275380 6/22 (27%)
leucine-rich repeat 677..700 CDD:275380 4/22 (18%)
leucine-rich repeat 701..748 CDD:275380 13/46 (28%)
leucine-rich repeat 725..736 CDD:275378 4/10 (40%)
leucine-rich repeat 749..772 CDD:275380 0/22 (0%)
LRR_8 771..831 CDD:290566 12/59 (20%)
leucine-rich repeat 773..793 CDD:275380 0/19 (0%)
LRR_RI 804..1076 CDD:238064 66/282 (23%)
LRR_8 821..903 CDD:290566 23/81 (28%)
leucine-rich repeat 821..844 CDD:275380 8/22 (36%)
leucine-rich repeat 845..868 CDD:275380 8/22 (36%)
leucine-rich repeat 869..892 CDD:275380 4/22 (18%)
leucine-rich repeat 893..915 CDD:275380 4/21 (19%)
leucine-rich repeat 916..944 CDD:275380 6/27 (22%)
leucine-rich repeat 945..968 CDD:275380 0/22 (0%)
LRR_8 967..1027 CDD:290566 11/59 (19%)
leucine-rich repeat 969..992 CDD:275380 0/22 (0%)
leucine-rich repeat 993..1014 CDD:275380 6/20 (30%)
LRR_8 1015..1075 CDD:290566 23/70 (33%)
leucine-rich repeat 1017..1040 CDD:275380 7/23 (30%)
leucine-rich repeat 1041..1064 CDD:275380 11/32 (34%)
LRR_RI <1047..1244 CDD:238064 34/107 (32%)
LRR_8 1063..1125 CDD:290566 18/61 (30%)
leucine-rich repeat 1089..1114 CDD:275380 7/24 (29%)
leucine-rich repeat 1115..1162 CDD:275380 12/29 (41%)
LRR_8 1163..1219 CDD:290566
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 6/22 (27%)
LRR_8 104..163 CDD:290566 20/106 (19%)
leucine-rich repeat 105..128 CDD:275380 5/22 (23%)
LRR_RI 107..438 CDD:238064 106/452 (23%)
leucine-rich repeat 129..152 CDD:275380 8/22 (36%)
leucine-rich repeat 153..176 CDD:275380 7/22 (32%)
LRR_8 176..232 CDD:290566 20/55 (36%)
leucine-rich repeat 177..200 CDD:275380 8/22 (36%)
leucine-rich repeat 201..224 CDD:275380 8/22 (36%)
leucine-rich repeat 225..258 CDD:275380 12/61 (20%)
leucine-rich repeat 259..310 CDD:275380 17/108 (16%)
leucine-rich repeat 311..344 CDD:275380 11/32 (34%)
LRR_8 343..403 CDD:290566 18/61 (30%)
leucine-rich repeat 345..368 CDD:275380 7/22 (32%)
leucine-rich repeat 369..390 CDD:275380 6/20 (30%)
leucine-rich repeat 393..417 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.